PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00007.1.g07800.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRF
Protein Properties Length: 390aa    MW: 41778.6 Da    PI: 9.3675
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00007.1.g07800.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.13.6e-24135179145
                           WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                                   d+epgrCrRtDGKkWRCs+++ + +k+CErH+hrgr+rsrk++e+
  Zjn_sc00007.1.g07800.1.sm.mk 135 DPEPGRCRRTDGKKWRCSKEAAPQSKYCERHMHRGRNRSRKPVET 179
                                   79****************************************997 PP

2QLQ55.91.3e-1974109237
                           QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                                   +FT+aQ ++L++Q+l+yKyLaa++ vPp+L+++i++
  Zjn_sc00007.1.g07800.1.sm.mk  74 PFTPAQYEELEQQALIYKYLAAGVAVPPDLVVPIRR 109
                                   8*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.0E-1073109IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.97974109IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.6E-1374108IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.711135179IPR014977WRC domain
PfamPF088792.5E-20136178IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MPYASLSPAG GGDHRSSTAT ASLLPFCRSS PLSSAYATTA PFFALPVVAV LGNGGSGGVG  60
EDAQLSGRWT RPLPFTPAQY EELEQQALIY KYLAAGVAVP PDLVVPIRRG LDSLATRFYG  120
HPTLSYGSYF GKKLDPEPGR CRRTDGKKWR CSKEAAPQSK YCERHMHRGR NRSRKPVETQ  180
LLPHSQSPSA MAPIAAQPLA AAASGRNFQS HSLYPAIAGS NGGGRGSNIS SPFSSSMGSS  240
QLNLDNTATY AALGGGTGKA LRYTGYGIRS LADEHNQLIS EALDLSSMEN QWRLPSYPQL  300
LRQSTVNSLS KMDRQPLSFL GNDFGTVGSV KQENQLRPFF DEWPKSRDSW PGLGDENTNL  360
TSFSATQLSI STPMASSDFS AASSQSPNGE
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0369881e-110BT036988.1 Zea mays full-length cDNA clone ZM_BFb0150I14 mRNA, complete cds.
GenBankEF5158401e-110EF515840.1 Zea mays putative growth-regulating factor 1 (GRF1) mRNA, complete cds.
GenBankKJ7279721e-110KJ727972.1 Zea mays clone pUT6086 GRF transcription factor (GRF6) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953585.10.0PREDICTED: growth-regulating factor 4-like
SwissprotQ6ZIK51e-162GRF4_ORYSJ; Growth-regulating factor 4
TrEMBLK3YT540.0K3YT54_SETIT; Uncharacterized protein
STRINGSi017449m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24633476
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-46growth-regulating factor 5